everything latest robots gizmos mobiles

Hacker Cup Qualification Round Answer

2011-01-08T23:57:00.000+05:30

this is the solution for the third problem

eavcqvveidqnarthtevhlpurmkfqnotpesgphnnlqtwyuhztvu
axcycyaxminpminpaxszitzitaxzitaxminp
aaqzeebdhdfeaxkxpkwnjxqbnhnxpcusuxnnrzkov
csmzjcxepgptfdcnkrncvvkcoumewvpvaxbyqoexwujwp
cwvswrheepfwggwgyonraikjeampdizqbotbnoazzsyyxcoj
dralemrspoeuswutihizqhtmpjsoieqpbdayaiflsujccnmumj
itqsgpwzekkahulammawxtfyhpncgzgbo
crmiciccrmiccrmcrmiccrmcrmmwpodoodocrmsil
bjnnuknqsfsrdgmgxflnkfrcuhjhpahilrvncvkvssdsouydwjmeagyob
ehhsmhhsmhehiihsmhxgxgehxgixnfc
eokrqkrqeokrqeokrqusauwweozltgzltgkrq
cdiqsevaxdeyrxbkbxdyrbqrhhfmdmtpdofbcvxedernxq
blplpbndtcndtclprwwwwwwbwwwr
dfgthxhxdfgtqqhxqhxhxdfgtqhxqvthzvow
ahkjjegzinwjuhtawmihwnnozzwtfsjtvnwtp
bwjijibwjibwjp
cupfacebookforhackerstudentsstudious
iwkflklkiwkfmmlkvvlkvmxmnz
fujvkgukjmokvzmzrodprjojpzbsroschpxugnefwlwpobp
gtkclmqgcaqgcagtqgcagtqgcagtqgcariwehfwehfri

Lenovo LePad comes next year in the U.S.

2010-11-15T21:19:00.000+05:30

Lenovo CEO Yang Yuanqing has the Wall Street Journal against confirmed that its Android-Tablet LePad next year in the U.S. market will come in the. Following an earlier statement Lenovo LePad should only be delivered in USA, when a suitable Android version was ready. Now, Lenovo seems to be confident that such Google can deliver. The China-launch will be delayed, however, there is also the LePad now until 2011 to come into the stores.

Dell developed Streak's successor, Opus One is running at 1.2 GHz dual core

2010-11-15T21:11:00.002+05:30

On consumer side on the due date will update Android 2.2 aka Froyo for Dell Streak feverishly awaitingthe PC giant is working - of course! - Already on a new version. That at least is on the blog Streak smart read. At a presentation on a small scale details were revealed. In May next year, the successor to the market to come. The "Opus One", the current code-name is, a 1.2 GHz dual-core processor and have the display resolution set clear 1280x800p. This information is of course to enjoy with extreme caution. Dell, however, carries on that with the 5 "-androids seems credible. And then to go on the same solid, too.

Exemode brings out 3D pocket camcorder

2010-11-15T21:06:00.002+05:30

The Japanese company Exemode has announced a 3D pocket camcorder, that for the 24 800 yen (almost 220 €) will come on the market months ahead. The 3DV-5WF takes 3D video with a resolution of 848 x 480 and 30fps, 3D images have a maximum resolution of 1280 x 960 The camera is not limited to 3D, 2D Video Mode comes with 720p. More Specs: 5.04Mpix CMOS sensor with 128MB internal memory and support for both SD and SDHC cards up to 32GB. All videos are shot with H.264/MPEG-4 AVC. There's a picture of the back after the break.

Obscure-digital-multi-user multi-touch

2009-09-10T11:27:00.003+05:30

Obscura Digital has its newest and longest multi-touch wall at the Hard Rock Cafe in Las Vegas unveiled. The monster is probably the interactive display with the highest resolution in the civilian sector.

The 5.5 meter display can seamlessly work with multiple GPUs, and divides the screen into a work space for up to six users. On the screen the mega-hard-rock Visitors can also browse through picture and movie memorabilia to the restaurant chain.
The HD display uses three projectors and gets along with 100 high-resolution photos and video simultaneously and in real time. Photos are shown for example with a resolution of 12 megapixels upwards. The sound system generates a precisely targeted to the location of the user audio output in order not to go different users on each other's alarm clock.

obscure-digital-multi-user multi-touch

Robot communicates nonverbally

2009-03-31T23:18:00.001+05:30

If robots one day at home and in public as a normal part of human society are accepted, they must be intuitiveto human action and respond to behave so that people understand it easier. At this year's "Human-RobotInteraction Conference (HRI) of the IEEE in La Jolla, California, researchers are now presenting the latestadvances in this field.Various scientific teams have long been looking for ways in which robots the subtle side of human nonverbalcommunication can detect and imitate: eye movements, gestures and physical contact. Mastering machinesonce these social niceties, which could help them, language issues and to work on human needs and respondto commands more precisely. This could be of enormous importance, experts believe, should actually robots inthe next few years, personal assistants, teachers or care assistance.Researchers at Carnegie Mellon University presented at the HRI first details of their experiments on a robot thatuses eye movements to the flow of communication with several people to steer. The technique was developedin collaboration with researchers from Osaka University and ATR Intelligent Robotics and CommunicationsLaboratory. The approach is intended, inter alia, for robots, as the receptionist in buildings or shopping malls, amuseum guide or tour guide work."The goal is to human communication mechanisms to be applied in robots so that human behavior correctlyinterpret and respond appropriately," says Bilge Mutlu, a member of the Carnegie Mellon team. "We want toeventually not unsociable, shy robot."The machine sounds from the experiments on the name Robovie and was previously developed at ATR. Thusthe robot language and views can combine, researchers developed the first accurate model of how people havetheir eyes during a conversation or discussion use. They dealt with the current literature in the field of socialcognition research, in order to develop predictive models to be able to. These were then further refined in thelaboratory data. All of that flowed into a software, which Robovie conversation in different scenarios can control.In the experiments, the machine played the role of a travel agency employee, the two trial participantswelcomed imagined them and then a series of questions, where they would like to outward. Three scenarioswere examined: the speech of a person, while others were ignored, the speech of a person, while the other withshort glances were perceived and the speech of both persons simultaneously, each with the same amount ofeye contact.The team found that the Robovie conversation flow easily, and could even lead. Those who are the robot thatwas longer, spoke more often, while those with only brief glances abbekamen, were less communicative. Thetest subjects were ignoring Robovie spoke as expected least. These patterns were roughly 97 percent of casesconsistently. In the future still looks Robovies for more non-verbal signals are added, such gestures.Another team, at the HRI conference attended by focusing on simple physical contact. With the help of a small,remote-controlled humanoid robot led researchers from the Netherlands through an experiment in which theyshowed how the robot volunteers convinced that he had them in the use of a computer could help. The testsubjects reported that the machine they like and less reliable machines happens, if this is made by offeringassistance and direct physical contact started - such as a knock on the shoulder or the high-five gesture. "Asnoted, that the way in which such behaviors are combined, plays an important role," says Henriette Cramer, aresearcher at the University of Amsterdam. Their team goal was to find out when and what physical contactworks. "We think that touch is an important aspect of interaction, and we want to further investigate effects -particularly in combination with other social behavior," she added."We want these robots to real human-like social skills lend," says Yale professor Brian Scassellati, Co-Directorof the HRI program. The field is still young, but it is growing fast. They can also learn much about human socialpsychology. "Actually, we have over the last decade, the necessary computing power and exercise capacity inthese machines, to really move forward."

IDOU: touchscreen mobile phone with 12-megapixel camera

2009-02-28T23:57:00.002+05:30

The new Sony Ericsson IDOU combines the benefits of the Walkman series with those of the Cybershot series. In summary, a huge 16:9 screen. Is this the iPhone killer we have to wait so long?

I had lots of touchscreen phones in my hands. But one in which the overall concept works so well, like the iPhone, I have not seen. So far at least. When I saw IDOU, I got the same big eyes: 12-megapixel camera, huge widescreen display and Walkman functionality. Since runs me like the water in the mouth.The only problem is that the device is still a prototype. Hence, there is still no known key data, except that it is running Symbian OS. A first sample is Sony Ericsson at the Mobile World Congress in Barcelona.The finished devices are probably in the second quarter of 2009. We must probably wait until ...

Samsung Monitor: 120-Hertz and 3D effect

2009-02-28T23:54:00.002+05:30

The new monitor is called Syncmaster 2233RZ and is 22 inches tall. With a refresh rate of 120 Hz is used in combination with a special glasses a cool 3D effect. This creates atmosphere in games and ...

... Enriching the one or the other film. The operation is relatively simple. 120 Hz correspond to 60 Hz per eye. The special glasses from Nvidia will ensure that only one eye at the same time is addressed. For example, the monitor shows one frame for the left eye. During this time, the right disappears, and vice versa. This is a 3D effect. How cool is something of which I was personally at times last year's IFA convincing.

The Syncmaster 2233RZ can also be like a normal screen can be used. The resolution is 1680 x 1050 pixels. Switching between 3D and 2D mode via a button on the side. To view the 3D effect is able to savor a special glasses from Nvidia with graphics matching the GeForce 8 series (from GeForce 8800GT), the GeForce 9 Series (from GeForce 9600GT) and all GeForce series of cards GTX2xx necessary.

Incidentally, the screen will cost 359 Euro and is available from mid-March to have.

Lenovo I60 and i60s: touchscreen phones all in white

2009-02-28T23:50:00.001+05:30

Lenovo may have more than laptops without or with additional display and all-in-one desktop computer, only recently has Lenovo's two new touch screen phones, which is Lenovo I60 and the i60s.

While the I60 a spacious three-inch touchscreen has the i60s sacrificing a little of this touch-screen surface (it measures 2.8 inches in the diagonal) ...

... For a few more buttons. The resolution of both displays is at 240 × 400 pixels, a further difference between the two versions is the battery capacity, while Dreizöller phone at 1250mAh and the model with the 2.8 inch touch screen is at 1000mAh. Otherwise, both phones are dual-band GSM (900/1800 Mhz), have an integrated media player, a radio, a two megapixel camera, Bluetooth, and can have a card slot for microSD cards with up to 16 gigabytes of storage volume.

Apparently, both models come with no operating system, therefore - and not with us, but at least the time being only in China. It had been expected but that is shortly to hold a Lenovo Android mobile phone on the market will bring.

Safari browser: Fast and classy

2009-02-28T11:19:00.002+05:30

Surprisingly, Apple has released a new version of its Safari browser released: The software is not only chic, but also pushes up pace - especially in the execution of JavaScript in the network become increasingly important.The browser market is powerful in motion. Each manufacturer currently provides an opportunity to gain market share. The effort is worthwhile, because even if the browser is distributed free, they are an extremely interesting source of revenue. As the browser manufacturers can the user to steer certain browsers, or on its own online services to your attention. Ultimately this means more traffic and thus more advertising revenue, directly or indirectly.That's why nobody wants to be the butter on bread in their efforts. Microsoft has released in the next few days, the official Internet Explorer 8, which has been considered as a pre-release courses, developed with Google's browser Chrome High continues, the Firefox community tüftelt to version 3.1 of its browser, and now even Apple has a new surprise presented version of Safari, but only as a beta.In the press release speaks Apple - totally immodest - the "fastest and most innovative browsers in the market." Exactly 4.2 times as fast as its predecessor, Safari 4 should be - at least when it comes to Javascript to execute. Javascript on the Web plays an increasingly important role, especially with online applications and at all sites, the Web-2.0-features. Without Javascript no interactivity.According to Apple Safari 4 will also be much faster than the competition: 30 times faster than Internet Explorer 7 and is still three times as fast as Firefox, 3rd However, compares Apple's new browser here with the old browsers of its competitors. Microsoft's Internet Explorer 8 is also super fast, also already in beta testing are Firefox 3.1 specifies the turbo on Javascript. Google Chrome is already extremely fast when it comes to Javascript scripts execute.All browser manufacturers take the issue seriously and try to pace, the fastest browser to offer. But Apple would not Apple, if the software does not even flatter the eye would. This point can actually Safari 4 points: The Apple now offers the browser of iTunes and the iPhone famous "Cover Flow". Previews controlled websites fly as 3D images on the screen. To make the surfing in the Webwelt fun.Quite new is the "Top Sites" called 3D view frequently visited websites, a little reminiscent of iChat, Apple's video and instant messaging software. Again, the web pages of thumbnails displayed in attractive 3D. What looks like a high-tech center director quickly turns out to be a practical starting center for their own favorite sites. But only works well on fast computers with fast DSL line. Even the appearance of tabs (tab) has been revised and now visually reminiscent of Google Chrome.Safari 4 is available for Apple Mac, Windows PC and iPhone and iPod Touch. Under http://www.apple.com safari can download the preview version. Currently there is only one version with English-language version, with the great man but clearly comes.

Web Apps on the phone

2009-02-28T11:17:00.002+05:30

If you are online on the PC, it is very easy to set up a new browser tab to open, a quick look or a friend an instant messaging message to send. Ditech Networks, a telecom equipment from Mountain View, California, will now similar functionality via telephone to offer: The company has developed a technology that enables users specific applications directly in a cell phone conversation can call.
The boundaries between the Internet and the traditional phone system to blur in recent years more and more. Voice over IP allows language in addition to various other types of data traffic over the normal network to transport. Smartphones, allowing easier access to the Web possible, offer a first language input options - as Google iPhone application in the program, when you vote in accordance with its online content may be used. Also available: Memo functions, the language of "live" show - the start-up Jott offers a service that consists of audio input makes texts.
Ditech hopes that his technique with numerous other applications via mobile phone use, without having the client device from the ear would have to take. "We make phone calls, voice and finally a genuine digital technology," said CEO Todd Simpson. Ditech The system is called "mStage" platform and is a software layer designed to mobile service providers in their network can integrate. MStage Once installed, a user can, for example, in a conversation over a business lunch by the same vote after the next looking for a pizzeria. A descriptor, such as the name of a pizza chain, immediately triggers a menu from which the user can select search application, which results in the telephone conversation by voice output. The platform can also short message that only the user hears the call into account - for example, that there is now an important date is pending.
To demonstrate the capabilities of Ditech mStage has a suitable application for the social network Facebook was created. If the platform integrates with the operator, this Web App friends indicate whether a user and then just phoned messages to weitervermitteln him. This could, according to Simpson, for example, be used, a fast friend on the evening eating plans to inform without his conversation entirely to interrupt.
A major challenge in creating such a system is the need to first create a large number of calls to scan for relevant commands to "hear". "The voting process takes place in real time," says Simpson. "We wanted a service that everyone at any time can be used. Therefore, the software at each interview, the network will take part." Ditech had given to a technology, which the company previously to improve the voice quality of mobile phone calls had developed. The first had to scan the overall communication to appropriate audio optimization measures.
Despite the processing of so many phone calls, the privacy of the user at all times maintained. Hossein Eslambolchi, technical advisor to the company, stressed that the analysis itself recorded conversations never would. Users could also lay down rules, when access is mStage and when not. In addition, activate the system only if it perceives a key concept. Also would be only the truly desired by the user application called.
Rebecca Swensen, analyst at IT market researcher IDC, says that the communications industry is due to the increasing number sprachaktivierter Web applications at a turning point. Thus, the British Telecom recently, the Internet telephony company . That was a sign that major telecom companies are currently in the direction of Web-based technology. "The traditional carriers have begun seriously to understand that they must do something to catch up."
Ditech mStage platform for mobile operators could be quite interesting, because it's the network to third party applications opens. At the same time but yet a sufficiently high degree of control by the operator - such as what services they offer and how well protected they should be. The question was, however, finds Swensen, whether people were ever ready, these new services: "The consumer behavior is the biggest hurdle."
Company Chief Simpson stated that there is mStage platform in about three months for testing the network. End users will only see the service as soon as Vodafone or T-Mobiles of this world is for him to decide. At the Mobile World Congress in Barcelona Ditech Networks already tried once to attention with his novel technique to attract attention.

Better results than google

2009-02-19T11:47:00.002+05:30

One of the hottest new areas in the Web-search methods by which the results based on the preferences of the user can be improved. It is sufficient to Google in, tried the search engine to personalize the results by clicking on previous queries back accessed. One student, who is looking after Seelebewesen, then receives, for example, to search for "Dolphins" less the same results for the U.S. football team and more about the marine mammals.
Surf Canyon, a start-up from the Oakland, California, is trying now to personalize the issue further. Its software, which is as an add-on for Firefox and Internet Explorer can be downloaded, completed, results of search engines, links clicked by the evaluated. Immediately afterwards appear improved results, including three bids, the most clicked on pages one way or another fit. "We have invented the real-time personalization," says CEO Mark Cramer.
If we look, for example, Google for "thermo-electric heat sinks", showing Firefox with Surf Canyon ten standard results. If you now click on one of the results, in this case, the chip manufacturer Freescale, will be transmitted to Surf Canyon. A click on the Back button then change the old results list: Three new proposals to land directly under the Freescale results. Surf Canyon has these links from the former Shown 100 result pages to extract. The tool is determined which of these fit Freescale.com information, including technical information, such as a thermoelectric cooler works.
The new results will be in the original integrated results that the page is not drastically different from the original. The users would otherwise verschrecken, Cramer believes, moreover old results are not likely to disappear because of the users so they may still want to click.Therefore, the recommendations appear only below the clicked link. "We do not want to annoy the users. Surf Canyon is specifically designed so inconspicuous as possible."
Behind the scenes is an algorithm for the personalization. Here are the results analyzed, which has been clicked or ignored, but also how much time the user spent on a search result.The algorithm also try the importance of a page to semantically analyze, says Cramer. The results build on: After a few clicks Surf Canyon can already decide whether, for example, for a Canon camera, a SLR camera or a digital SLR camera from Canon is interested.
Marti Hears, a professor at the School of Information University of California, Berkeley, praised Surf Canyon for its presentation of the additional links - which is clear, useful and unobtrusive. So the user does not need such as Google's "SearchWiki" themselves up, to sort search results.
In an attempt was Hearst, however, revealed that the newly designed results are not always worked. "The personalization works especially well with ambiguous questions," she says.Today, however, users tended to be longer entries, which provides advice contained what was sought. In one test could Surf Canyon, according to Hearst also an acronym only to a certain point back - they got different results, although they are already with their first clicks had made clear what they wanted.
Cramer and his team, however, speak almost only positive feedback. In a study with two groups, the standard results and those displayed by Surf Canyon got clicked, participants 30 to 40 percent more often by the algorithm adjusted results.

New appetite for small game

2009-02-19T11:43:00.002+05:30

From minor matter because: According to the International Game Developers Association, the

turnover in 2008 with so-called "casual games" - games for little in between - has generated at around 750 million euros. Last year there were about 560 million euros. Apple, it was at least at the Casual Connect Trade Fair in Hamburg to hear, has worked with the iPhone and the iPod Touch the market for mobile games completely revitalized.
In Hamburg's Congress Center was not only gefachsimpelt, but also dredged, according to the motto: "Do you want to see what new I have?". However, experts predict the square deer Nintendo and Sony hard times. Because: "Apple has the iPhone done everything right," says Michael Schade, co-founder and CEO of Fishlabs, a German mobile games forging that deal with high-quality 3-D titles, a name in the industry has made. "You take the device into the hand, which looks good and feels great, then you make the App Store, which works immediately, things can quickly durchbrowsen see screenshots, will find a detailed description - the shopping is fun. And that is so much better resolved than if you get games on your mobile phone network operators want to provide. Because in the end to buy a pig in a poke, "said Schade.
The supplier for many typical practice, a game for mobile download, have been criticized from many sides. Some of David Ben-Ami, Senior Vice President of Oberon Media, one of the largest providers of casual games. Yet had the iPhone and iPod touch is not everything."Good work the same title on other platforms," said Ben-David. Pocket Gamer editor Chris James gave to concerns that beyond the need to look across. "The music industry has to start the iTunes Store praised, but with time, the positive voices have become increasingly rare." Also, would remain to be seen how the price develops.
Despite all the concerns but the gist was clear: Apple has the market - at last - and the subject umgekrempelt Mobile Games made presentable again. Nokia was the first, despite all the efforts are not successful. "Physical disks are obsolete, this is snow from yesterday," finds Michael Schade. "Digital distribution is the model for the future." Ergo need to Sony and Nintendo attract warm. However, it is both not too difficult to re-orient. In the competition on the stationary console market, Sega in the past and was involved in the last few years, Microsoft mitmischt, the product developers more than enough expertise to move forward.The current situation, however, is extremely exciting: Nintendo will soon be here in the DSI on the market and we demonstrate what it means to be a fun machine with an online shopping channel in the hands. In addition, location-based games, formerly known under the term Augmented Reality subsumed are coming in, but the DSI may also soon play a role. Moreover romp with Google open mobile operating system Android, but more ambitious new developer. Meanwhile shatters one at Nokia and Facebook's head, such as gaming community with flair to the mobile suit.
Who would have all the expected two years ago? There were clouded with many faces at the Casual Connect. Who thought of mobile games, raufte of the hair. And all of a sudden everything is different. Within a few months is a minor matter to become principal. Rohith Bhat, managing director of Robosoft Technologies, vorbeiströmendne tries to show visitors his latest iPhone games with enthusiasm, with one with a bow must shoot balloons rising. "It's easy to play!" Bhat advertises with a friendly smile. Playing with the iPhone or iPod touch is in vogue, the App Store on everyone's lips. How long this will remain so, none of the officers ventured in Hamburg to predict. It is not much expertise to predict that Apple is in the field of mobile games very soon there will be many imitators

Rapid share tricks part 2

2009-02-13T12:46:00.001+05:30

I knew a lot of us here use Rapidshare to download and disclose a lot of substance. It's quite annoying when we were incapable to download for a certain interlude after downloading a big dossier. What are departing to be communal today is how to download from Rapidshare with deputy so that you won't have to face the 1 hour limitation puzzle again.

The programs that we necessary are a browser with ability to use deputy. I use Slimbrowser for two reasons:

1) I don't want to delete my Firefox or IE reserve and cookies annals.

2) It's very lite and not a source hogger

Steps:

1. Download the browser

2. Get an alternate directory here. This deceived requires the procedure of deputy attendant to work. So don't skip this walk. Grab one alternate or more!

3. This is how you are going to complex your proxy

:Click Tools > Proxies > Organize Proxies

- In the Name tackle, pierce something to recognize your proxy, for example, Brazil #1

- In the first address sphere, record the surrogate address you got from Proxy4Free,

for example, 200.162.195.62

- In the minute address meadow, input the proxy docks, for example, 3128

- If you want to set the entered surrogate as the evasion surrogate, then click the

Set As Current Proxy knob

- Click OK to close the dialog box

If you want to add more proxies, replicate the steps above again and again.

4. After you have group the proxy, photocopy and paste the Rapidshare download relation to your

browsers’ address bar, and delay for the Rapidshare page to launch.

5. In Rapidshare website, do the followings:

- Press enter and scoll down to foot and click the FREE switch Wait until the offset reaches zero or use any auto-divulge-linkage-benefit

- Copy paste the download link into your darling download manager, for

example, Flashget

- Download the dossier merrily

Troubleshooting

Note that if Rapidshare gives you blunder like this;

This IP is not tolerable to use released anonymous military.. Or Your IP, xxx.xxx.xxx.xxx is downloading a parade…

It's time to use another proxy!!! In Slimbrowser, go to menu, Tools > Proxies and select another proxy you already entered before

6) After downloading an organize, don’t forget to plain your remnant!

In Slimbrowser go to menu Tools > Internet Options to open the Internet Options applet

Click both Delete Cookies and Delete Files close to wipe out all references to Rapidshare. If you require to download more store, reiterate all steps from 1 to 6, and hopefully you’ll be happier than ever.

Tips:

1. Do not pick proxy with port 80

2. Avoid choosing proxies addresses

Latest rapidshare hacks-part1

2009-02-13T12:32:00.002+05:30

Hacking rapidshare to free host files and website

Universal Share Downloader (USDownloader), also called RapidShare downloader or MyTempDir downloader is actually not a crack or chop directory. Instead, Universal Share Downloader is a download director for automated download a catalog of archive from most stream boundless uploaders or gratis limitless upload archive hosting servers such as RapidShare, MegaUpload, YouSendIt, FileFactory etc.

Normally, if you’re not premium organ or rewarded associate or upgraded affiliate of the unbound boundless or one-click summary hosting, web cosmos and record transfer rite, the service will has some limitations when you try to download the annals from the attendant, such as no concurrent matching download, so you have to download one troop after another chafe has ruined downloading. Beside, you’re also imperfect to certain download bandwidth edge based on time and IP address, download time postpone (cache “download ticket” organism and no time download fright) and slower download zoom.

AllFiles, Audiofind, Badongo, BestSharing, Come2Store, Datenko, DepositFiles, EasySharing, FileDepartment, FileFactory, FileHD, FileSpace, GetFileBiz, HemenPaylas, HyperUpload, iFolder, MegaShares, MegaUpload, MyTempDir, Quickdump, Rapidfile.fr, RapidShare, RapidUpload, RecFile, SaveFile, Sendmefile, SexUploader, ShareAm, SimpleUpload, Slil, SpbLand, StoreandServe, SupaShare, TurboShare, TurboUpload, UniversalVideo, Upfile, Upload2, Uploading, UploadPort, UploadSend, WebFile, WebFileHost, YourFile, YourFileHost, YourFileLink, YouSendIt and zShare

Note: For alternate servers tilt, you can download software called GeoWhere and use GeoWhere to explore for presented surrogate servers on the Internet, and put all the found proxies into a content smooth. You should use only unsigned deputy, as transparent deputy will divulge your IP address too. Alternately, several websites has a long catalog of open shared surrogate servers that can be used by the USDownloader such as Proxy.6te.net, Proxy.org. Proxy Listed even allows you to download list of surrogate servers in a passage rasp plan (consider to download only ordinary or elite proxy by incisive for the form before downloading).

Best of all, Universal Share Downloader is a freeware, and no installation required. Just download the Universal Share Downloader v 1.3.4 Beta 8 zip march , drag it and run the USDownloader.exe. The the limitation of Universal Share Downloader compose powerless to download ordinary download family (it workings on the sleeve allotment/hosting military only), and it itself yet to prop similar, concurrent and multi-threaded downloading in current (1.3.3) variety (to permit it now, you have to launch numerous USDownloader.exe

Macbook in a Phone

2009-02-09T13:56:00.003+05:30

While the point does have some issues like the inelegant string jacket at the rear and some tough edges here and there, the inclusive cause is wholly stunning

The modern rumor suggesting a likely next generation iPhone in the making has resulted in a downpour of mind-blowing view imagery over the last week.

One view that has managed to point a few heads is a specimen that first appeared on Gizmodo. The iPhone 2.1, as the successor is being touted, is a badge that will be 4G compliant and could be manufactured through Apple's aluminum unibody enclosure production procedure. While this is just an unofficial concept, users who saw the outline took a direct liking to the same. While the outline does have some issues like the awkward string encompass at the rear and some tough edges here and there, the inclusive stimulate is fairly stunning

Few key skin:

• Titanium and Glass.

• OLED guard

• 3G

• GPS

• Front camera for iChat

• Removable battery

• 3.2 Megapixel camera

• Video

• 32 GB

Square is the new cycle

Facebook banned

2009-02-09T13:45:00.002+05:30

Good news just from apple store computers

A few moths after Apple blocked MySpace access from their spectacle machinery at Apple retail supplies, its time for Facebook to get a related action.

The company has reportedly happening blocking access to Facebook because often, people frequented the food who have no other meaning but to breakers Facebook and do so by pretending to be feasible Apple costumers. This in turning affected the 2248 customers on typical that outing the Apple stores to have a look at the Macs on pageant. An employee at one of the stores has divulged to folks over at Ars Technica that the hunk has been in make for just over a month now. Facebook has hence fixed the long inventory of websites that linger blocked in an Apple gather.

So, if you were opinion of a swift hop to the district Mac store to your contacts Facebook, unluckily, it's not possible any more.

New OsX borrows feature from it's sister iPHONE

2009-02-09T13:42:00.001+05:30

Apple's next working organism Mac OS X 10.6 will reportedly sponge skin and tools from iPhone. Two major functions of iPhone OS - Multi dash and Geo-setting will be implemented in the Snow Leopard.

AppleInsider's gossip, a pre-issue specs of Snow Leopard OS includes CoreLocation framework which comes candidly from the iPhone OS SDK. Current room and longitude of the Macs running Snow Leopard would be identified through the CoreLocation framework. Wondering how? Mac's networking hardware will be converged with Internet to broadcast/split presented position of the Mac since no GPS chips are embedded on Mac gear.
The Silicon Alley Insider points that Apple already uses Skyhook Wireless in the iPhone and iPod Touch which uses database on Wi-Fi hot spots for identifying addict locality based on GPS platform.

The patent engaging multi-hint facet of iPhone and iPod Touch would be incorporated in MacBooks, MacBook Pros and MacBook Air on Snow Leopard. Developers presently marks applications for Snow Leopard will be able to incorporate multi dash in their programs through Cocoa-based programming interfaces. And after charming multi-meet patent for iPhone recently, it's likely that Apple will exploit the same on their Mac machines.

Not to overlook, both Mac OS X and iPhone OS are based on same foundations of codes and libraries. Hence, incorporating multi-touch and geo-setting skin in Snow Leopard may be less bothersome.

Coincidentally, this new follows after Google recently rolled out Google Latitude facet in Maps for Computers and Mobiles.

The skin of Snow Leopard have raised expectations and we can expect to drawback a preview of it at the World Wide Developers Conference in June this year.

JaJah for Iphone

2009-02-08T10:55:00.003+05:30

Jajah isn't the first VoIP app for the iPhone/iPod join, but it's the first that lets you fling/entertain SMS letters over wi-fi. I got an instruct look at it, and so far, so good.

Previously, the JaJah app for the iPhone was worn as a middleman to connect pople on VoIP to your phone, but it still essential a movable diagram, and worn resume. Now, the Jajah app facility utterly over wi-fi, gist you can use the iPod dash, and make calls without a mobile table. It also facility on the iPhone, but won't work over 3G or EDGE, because then AT&T wouldn't make any money.

The force of this Jajah app is simplicity, and that is a good thing. It doesn't try to work with a million different communication army (such as Fring or IM+), and it maintains much of Mobile OS X's strategy DNA. This makes the app awfully cool to use.

Placing a call is as minimal as selecting a link from your file, or bringing up the dialpad and incoming a number. Similarly, transfer a wording over IP (versatile for international SMS) looks like it's pretty much the same as transfer a routine SMS, excepting that you're inside the JaJah app. I got to see the UI for sending a SMS, but because the advantage isn't set up yet, I didnt get to see it go through.

As for call value, voices sounds a tad on the ringing fringe, but not to the size that I would say it's bad property. There's also a few seconds of lag while the data passes through JaJah's servers, yet that's no mammoth alarm each.

The cool thing is that JaJah would like to work with Mobile Carriers on branded solutions, and suppose carriers to agreement absolute measure VoIP service with the JaJah technology. This means you wouldn't require to buy reporting, you'd just pay one dough quantity every month for infinite use. In any instance, VoIP junkies should look at JaJah when it comes out in a few weeks.

157 social bookmarking sites

2009-02-08T10:49:00.002+05:30

Respect the purpose of these sites and please use them only for socialbookmarking and not spamming etc.Some of these sites need an invite like blogmark. Please mail or write in a comment to get one

1. Stumble Upon(my favourite)
2. Lensroll.com
3. del.icio.Us
4. Digg.com
5. BlinkList
6. http://www.twitter.com/
7. Technorati

8. Gather
9. Ma.gnolia.com
10. Newsvine/

11. Netscape.com
12. Blogmarks.net
13. Cutulike.org
14. Furl
15. HubPages
16. Bluedot.us
17. Clipmarks
18. Ning
19. Simpy
20. Squidoo

21. Spurl.net
22. Wink
23. MyWeb Yahoo
24. Zlitt
25. Rollyo: Roll your search engine
26. PlugIM
27. iLike
28. BibSonomy
29. Blabb
30. Bookmark-Manager

31. Backflip
32. Aboogy
33. A1-WebMarks
34. Connotea
35. Google Bookmarks
36. Kaboodle
37. MindDeposit
38. LiveFavorites
39. RawSugar
40. Rojo

41. Shadows
42. Icerocket
43. Spotback
44. Askville
45. BlinkBits
46. Band Buzzer
47. BlinkPro
48. Bookmark Buddy
49. Blogmemes
50. BookMark Commando

51. Sync2It
52. BuddyMarks
53.Bookmark Magic
54.BookmarkTracker
55.Butterfly-
56.bookmax.net
57.C2NN
58.claimID
59.Clickmarks
60.Connectedy

61. del.lirio.us
62. Socail Anotation
63. Easybookmarks
64. Dogear
65. Dohat
66. freelink.org/
67. Frassle
68. Finety
69. Complore
70. GlobusPort

71. fungow
72. Guicookies
73. GetBoo
74. Humdigg
75. Dude Check This Out
76. hamiltontechgroup.com
77. i89.us
78. HyperLinkomatic
79. iFaves
80. ikeepbookmarks.com/

81. Jots
82. kmfavorites.com/
83. Linkroll
84. links2go - Targetted Directory
85. favmark
86. favoor
87. LinkGogo Society
88. Linksnarf
89. Lookmarks
90. Markaboo

91. Link2Mark
92. Mobleo.net
93. murl.com/
94. Lounge
95. memFrag
96. WaveRight
97. myHq
98. My BookMarks
99. myhotlist.com
100. My Bookmark Manager

101. linkatopia.com
102. mywebdesktop.net
103. My Link Vault
104. Netvouz
105. OnlineBookmark
106. PeerMark
107. openBM
108. Philippine Bookmarks
109. Powermarks
110. Riffs

111. Plug Web Edition
112. SearchFox
113. Shoppers Base
114. Shakk.us
115. Searchles
116. Share Your Links
117. Scuttle
118. SiteJot
119. Smarking
220. SiteBar

121. StartAid
122. Sports slister
123. socialbookmarking.org
124. an.geli.ca
125. Smelis.com
126. URL Blaze
127. Unalog
128. URLex
129. Taggly
130. SyncOne

131. Whitelinks.com
132. Wists
133. What link
134. Weeb-Feeds
135. womcat.org
136. World Wide Wisdom
137. wobblog.com
138. wURLdBook
139. yourMarks
140. zurpy

141. Zoogim.com
142. lilisto
143. Spotplex.com
144. SpotBack
145. CoRank
146. Openserving
147. TagTooga
148. 30DayTags
149. plime
150. Sphere

151. Mog
152. Vimeo
153. NewsWeight
154. Reddit
155. CrowdFound
156. Starton
157. GaddiPosh

Multi touch hack for G1

2009-02-08T10:20:00.004+05:30

Android's new 1.1 update doesn't embrace multitouch because Google is scared of Apple. We are not, however, and, nor should you be-trail our show to get iPhone-like multitouch browsing on your G1 right now.

Many merit in particular to the, those at the xda-developers forum, the #1 hangout for HTC receiver tweakers on the web.

What You'll Need:
• Your G1
• USB twine
• JFv1.41_RC33.zip-an Android RC33 ROM With Multitouch assembled by a polite chap that goes by the name of JesusFreke.
• An old RC29 ROM (with ransack access bug)
• An Android recovery image
• A micro-SD license bookworm (possibly, if you disarray equipment up)
• The Android SDK(for installing more multitouch demos)

Let's get ongoing:

Downgrade Your Android Software to Gain Root Access
Even while Android is open find, access to default disabled the nose abuser, so you still have to get cause access. To do that you have to exploit a well publicized bug in an ahead Android develop that clearly allows you to skid into basis access simply.

Note: In doing this, you will waste everything you have saved to your receiver. Your synced Google Account word will of course delay put, but you'll squander your installed apps, content post, and something you have on your SD license. Searching "help" in the Android Market will mandate you to apps that can support your SMS post and other annals.

Your headset is prone operation whichever the RC30 (1.0) or the new RC33 (1.1) side of the Android software (you can delay under Settings -> About headset -> Build number). RC29 is the one with the bug, so you'll must download that file here

2. Reformat your headset's SD license to the FAT32 method.

Rename the downloaded sort to right this: DREAIMG.NBH in all caps for the expansion and the filename. It matters. It will still show up with a lowercase extension in the bootloader, but that's OK, while the chafe you dropped on your SD license was named properly, you won't get a FAIL.
Drop the downloaded and renamed RC29 dossier onto your SD license via USB, force your call off, and then capacity it back on while property down the camera close. This will take you into the bootloader. Press the dominance knob to twitch the renovate, which will wipe your headset and ensconce the old software.
When it's done you should get a declaration of victory. After that, hit the trackball badge (known as the "action knob" in the darker recesses of the G1's bootloader) and then force Call, Menu and End simultaneously to reboot into your downgraded G1. You'll see that you're first from scuff.
Sign into your Google account and then grab the "Telnet" app from the bazaar. You'll neediness this to exploit your newly gained source access.

Update Your G1 With a Multitouch-Enabled ROM
Now that you have not only the permission but the impulse to do naughty clothes with rummage access, it's time to mount the updated Android records.

A fine assembled these chap that goes by the name of JesusFreke on countless headset-hacking forums. He's the one, primarily, who made all this multi-stirring on the G1 probable.

Grab Le Freke's RC33 v1.41 ROM (the one with multitouch goodness baked in) and rename it from "JFv1.41_RC33.zip" to "update.zip"-all lowercase-and reproduce it to your SD license.
Also grab this grab this tweaked "recovery.img" sleeve and photocopy it to your SD license. Eject your SD card from your desktop and unplug the USB cable when you're done.
Now that you're in the exploit-y RC29 kind, your handset will dawn responding to diverse Linux orders you nature on the keyboard no subject what you occur to be doing in Android at the time. Fun! What you penury to typeface to get rifle access is:

telnetd

You may find yourself in some odd place in the OS, but it doesn't stuff-if done exactly, a telnet attendant should be running in the background on your telephone.

Open the Telnet app you downloaded from the Market, style in "localhost" in the box if it's not there already, and tap "Connect to attendant." You'll see some bizarre ASCII characters, but all should be well. To analyze, print this in at the punctual (make effective you've expelled your SD card from your mainframe and detached the USB cable):

ls /sdcard

You should see the names of the documents you banal (if you don't, try walk 3 and 4 again).

Now it's time for some more command line trickery. You'll must to print four more tips to mount the rasp method in a writeable aver, change to the technique list, item the recovery.img organizer from your SD card to your ring's /practice register, and race the recovery persona, in that order:

mount -o remount,rw /dev/obstruct/mtdblock3 /practice

cd /system

cat /sdcard/recovery.img

flash_image recovery recovery.img

You won't get any answer from any of these orders other than a slender linger before the next rapid appears-that means you've done everything rightly. If you get any mistake post, curb for typos and try again.

Power down your ring, then weight it back on again. One swayed cycle is necessary to total the allure.
Power down your handset AGAIN. And now, while off, shock it up by asset the Home badge along with Power; your ring will penetrate into recovery manner, which generally shows a caution icon with a receiver, but will in this lawsuit onslaught a bunch of Linux symbols on the partition. Wait at that to calm down, and you will catch the ROM irregular transmit of Mr. Freke's target. If all looks good, compress Alt+S to sparkle your ROM, then press Home+Back when prompted to revive into your multitouch-enabled G1.
Open the browser, and try the ol' pinch-to-zoom gesture. Hey, what's that? Zooming! Its not lighting hasty at the minute, but I'd say it still beats burning positive and minus buttons to zoom.

While Mr. JesusFreke is responsible for packaging this up for consumption, we can thank Mr. Luke Hutchison for the actual multitouch coding. His blog sheds more insight on the splendor of the multitouch implementation your now live with, and illustrates how it will shortly better. Nevertheless let's play some more.

Download More Multitouch-Enabled Apps
In the flashed ROM you just installed, only the WebKit browser has been tweaked to accept multitouch store. Nevertheless your fun shan't finish there. Hutchison has provided a few more sample apps-with a minimal Google Maps app, photo browser and fun Multitouch visualizer. You can download them all in .Apk present format from his situate.

To establish an APK envelop via the Android SDK, make indeed you've enabled "Unknown sources" under Settings -> Applications, these instructions for Windows or, for Mac:

Open the Terminal and cross to the list where you unzipped the Android SDK (you can vehicle-pervade the Unix course to any column or almanac in Finder by dragging it to the indicator face in Terminal):

2. Then, with your receiver plugged in via USB, nature:

./tools/adb induct

After the "Success" meaning, voila, the app is now on your buzz.

And that's about it! Enjoy multitouch browsing, and for more Android hacking on the G1, restrain out these sites:

References
• AndroidWiki
• XDA Developers Wiki
• XDA Developers Forum

original article by gizmodo modified for better understanding

Whose a better pirate mac or windoze

2009-02-08T10:15:00.003+05:30

TorrentFreak tartan some seed and leech figures of Mac, Windows, and Linux software to see who's got the nicer ratio. The fallout wasn't lacking issues, but do intimate that Windows users/thieves are more polite.

First, the caveat, and it's definitely a biggie. These facts don't necessarily spot to specifically Mac, Windows, or Linux users: Windows users may download Linux software, Mac users may download Windows software, and so onwards. So this is not any kind of ironclad hardship. Nevertheless it is a fair assumption that there is a firm correlation between platform and software downloaded, and these records are different enough to at slightest imply that Windows users do certainly piece more than either Mac or Linux users.

The Pirate Bay, the web's major informant, was the informant worn for these numbers, and showed obviously that Windows software disclose ratio is more than twice that of Mac or Linux, at 2.55. Mac software clocked in at 1.19 and Linux at 1.39.

This information doesn't say something more than that Windows software is both more current to pirate(duh, more users and all) and has a, much higher common share ratio. Any conclusions you want to draw from that is up to you, but here are a few arranged conclusions I've tranquil.

1. Windoze sux.
2. Linux pwns.
3. Mactards are greedy little punks with no consideration for their fellow trivial crooks.
4. An ordeal conducted by comparing clients used to download the software would be much more interestin and accurate.
5. Battlestar Galactica was truly good this week.

Bookmark Syncing Available for IE, Safari

2009-02-07T14:07:00.001+05:30

Foxmarks, our choice to keep Firefox bookmarks synced across computers, is now available for Internet Explorer and Safari, giving somebody with multiple computers or browsers an agony-gratis way to keep it all together.

Foxmarks offers really the same print of background bookmark-syncing awesomeness for IE and Safari as it does for Firefox, with a few key exceptions:

No password syncing: A tough collapse, but not too hard to overcome by using Dropbox as a thwart-platform password syncer.
No syncing bookmarks to your own server: Probably not an agreement breaker for most users, but we chance it makes a viewing some day quickly.
IPhone sync only for Mac Safari: Actually, this isn't an aspect Foxmarks even offers for Firefox, so it's kind of bonus.

If you're still down to try out Foxmarks in its newest forms, regulate to the Foxmarks downloads page and grab your appropriate installer. I require a Mac scheme, so I'll be stepping through an Internet Explorer procedure below.

Double-click the installer, accept all the standard "Do you want ..." and "Allow ..." prompts, and you'll be asked to also found a Foxmarks account or indicator in with the one you've got. After verification,
The default action, if you purely hit "Synchronize," is for Foxmarks to merge any favorites you've got on your approach with something backed up in your Foxmarks cloud. That's beautiful for newcomers, but I commonly like to get ridding of all the pre-deceptive MSN, Windows Live, and analogous bookmarks, so let's hit "Change sync settings" and lever it up
After that, Foxmarks gets untaken. Instead of installing an icon in Internet Explorer's foot category bar, Foxmarks plants itself in your system tray. You'll see it pop up a notification when it's done grabbing or placing bookmarks to/from the servers. Right-clicking the icon gives you reach to your Foxmarks settings, can open your web-based bookmarks browser, and close down the Foxmarks route. It seems to run about whether you've got IE up and operation, which rather recall insensitive, but also convenient to those who open and close their browser steadily.
The Foxmarks options are parallel to what Firefox users have been used to: a fast-sync switch, choices on how and when Foxmarks synchronizes, and, best of all, the same kind of mainframe-by-mainframe selective bookmark syncing, or "profiles."
And here's the superior options, where you can change your encryption anxiety, weight a server- or notebook-wiping sync, and walk off that Foxmarks tray icon. Turning off the icon still lets you at the Foxmarks options from IE's "Tools" menu:

Safari users, be certain to tell us how Foxmarks is effective for you. Does tri-browser Foxmarks open a new realm of synchronized browsing? Waiting at just one more platform Give us your reviews in the remarks.

visit here : Foxmarks

Printable Checklist

2009-02-07T13:57:00.002+05:30

Web located Printable Checklist is a stripped down checklist inventor that makes edifice fleeting, imprinter-gracious custom checklists a breeze.

I fancy launder pen and paper for most of my to-do catalog management. I affection web-based to-do managers, but if I'm being upright, most of my daily to-dos are printed down on an unmarked instance of paper when I begin the day. I also have repulsive handwriting and am inexpert at creating checklists that look and feel like something you'd actually want to consult. With Printable Checklist, I can rapidly fashion and engrave out clean and simple disposable checklists that I can consult throughout the day, and I still get the satisfaction of glance off a large box whenever I finished a to-do. It's also ideal for creating a vivacious paper checklist for someone also without requiring them to suffer through your ghastly handwriting.

The place doesn't force any registration, but the downside to that is that the checklists are also very much disposable. If you wanted to prevent a checklist, I'd advise printing your checklist as a PDF . I've given the site hasty tests on Firefox, IE7, and Safari, and so far all seems to work. If you give it a try, let's heed what you think in the remarks

visit here : Printable Checklist

Simple YET sTYLISH time tracker:timeEDITION

2009-02-07T13:50:00.003+05:30

Windows/Mac OS X only: Time tracking application TimeEdition tracks your time in an extinct-regular and attractive line that saves your progress to Google Calendar for accessible-from-some place results.

Using the application is as unfussy as incoming in consumer, forecast, and errand details with the fall-down reins and clicking the Start tape badge. Your records is tracked across all projects and can be exported in Excel or iCal plan—but the true beauty is found in the options panel, where you can desire to sync your activity with Outlook, iCal, or even Google Calendar.

Unlike gCalTasks tool that only runs in the Vista sidebar, the application lives in your practice tray—with a relaxed-access milieu menu that can wallop between projects on the fly.

TimeEdition is free and open cause, facility on Windows or Mac.

download here http://www.timeedition.com/en/downloads.html

A Good Week For Cheapskate Gamers

2009-02-07T12:41:00.002+05:30

Rolando Lite: While charging filled penalty for what should arguably be a boundless upgrade is one App Store trend we'd like to see die (see below), here's one that's great: lite versions of the most common non-open playoffs. Rolando is fantastic if you asylum't played it yet, and now you can try before you buy with the liberated Lite, which is narrow to the first stage only. Free.

Super Monkey Ball Lite: And what ho? A released lite kind of Monkey Ball too with three stages from the gorged ready? Keep it up tough publishers, keep it up.

X-Plane Extreme: It's kind of maddening how X-Plane keeps packaging new planes into all-new editions of the app, charging 10 bucks for each one, but X-Plane Extreme does look pretty great. This one's bringing the armed jets, from the F-22 Raptor, B-2 Stealth Bomber and the ol' SR-71 Blackbird spy even, and they look beautiful. If you haven't bought X-Plane already and dig flight sims, Extreme looks like the report to get (there is also one for Airliners and Helicopters, if that's your thing).

Light Bike Full Version: On retailing for a lowest for a narrow time only, this is the just-released rotund kind of Pankaku's Tron brave with the humbling two-hands-one-iPhone four-player genre we liked so much when we first saw it. Very cool. $1

Digital Bass Line: I've been wanting to play with Korg's awesome DS-10 synth software for the DS for pretty sometime, but until I get my hands on it, this great Roland TB-303 emulator will surge me over. The 303 is the bass synth companion to the legendary 808 drum robot, and it's reproduced wholly faithfully here-genuinely fun to play around with, even if you're not a musician. It's $5.

Almond Emulator: And lastly, do you ever get the discern you're watching someone elude their attention via disconnected clues? Like, say, the iPhone apps they write? The Almond Emulator costs $1, and offers the chance to lean, smell, feel and snoop to a digital on-cover almond; each badge pressed cleanly changes the copy above to read "It tastes just like an almond." Riiiiight. Probably the strangest app I've seen-kick this guy a money, he needs it to restock his meds

Kindle 2 Official Images and Price Leak: $359 on February 24

2009-02-07T12:36:00.002+05:30

Mobileread just got a bunch of executive-looking Kindle 2 images which show it in assorted states being held and read, benefit report that it's being released for $359 on February 24.

From the photos, it looks definitely a LOT thinner than the first, and possibly even a bit slighter too. Unless that man has enormous hands, the Kindle goes from the tip of his average feel to faintly below his wrist—not too mean.

The photos may look fantastic and the gossip, by association, may look approved, but we don't know with 100% certainty that this is the actual cost and actual issue time awaiting we hear from Amazon

Ten Gmail Labs Features You Should Enable

2009-02-07T10:32:00.000+05:30

Gmail has been leisurely but certainly rolling out cool new features ever since the happening Gmail Labs. If you refuge't taken benefit of the fruits of Labs, here's a look at 10 Labs features you should allow.

Offline Gmail
Probably the most significant item you can get out of Labs, Offline Gmail takes lead of Google Gears to fork Gmail into an offline dispatch client. You can hunt most of your send, glug new mail, and do sweet much everything you can do with Gmail while you're coupled to the internet. Gmail automatically detects whether your related or not to keep your offline and online Gmail in sync.

Multiple Inboxes
Got a widescreen observer and a lot of filters and labels you want to keep an eye on? When enabled, Multiple Inboxes displays up to eight different searches or labels next to your inbox for a queen-sized dashboard of your send activity.

Tasks
Google has taken a lot of flimflam for not creating a to-do catalog app to spherical out their productivity suite of apps. Tasks may not be a detailed-fledged app (yet), but it's a great edge. You can even seizure a send into a duty with an easy Shift+t keyboard shortcut. Once set up, you can add errands to your Firefox sidebar and access it from your booth phone and iGoogle.

Go to ticket
Gmail has all kinds of great piano shortcuts, with combo keys that take you to your inbox ('g' then 'i'), starred mail ('g' then 's'), and more. With Go to brand enabling, you can abruptly route between labels from your upright in a related approach. Simply print 'g' (Go), 'l' (Label), and then depart typing the name of the marker you want to go to. Go to class will autocomplete the sticker, so odds are you'll be there in a pair of keystrokes. Go to identify also facility with the next Labs mark, Quick Links.

Quick Links
Quick Links adds a new sidebar to Gmail just below your labels. When enabled, Quick Links can be worn to bookmark anything in Gmail, from a frequent pursuit to a definite transmit. It's an incredible way to set up sudden access to usual searches lacking locale up a filter and label.

Superstars
By evasion, Gmail ships with one fair star to help you better keep trail of, and call out important emails. With Superstars enabled, you've got a massive 12 different icons to take from. You can even quest for different megastar types specifically—especially usable if you want to set up some Quick Links with your Superstars!

Canning Responses
Do a lot of repetitive typing, do you? With Canned Responses, you can set up canned replies so you can speedily and simply fire off that same old respond lacking succumbing to the pains of RSI. Your hands will thank you. (If you're truly sober about canned responses, ensure out Texter [Windows], TextExpander [Mac], or Snippits [Linux]).

Custom Keyboarded Shortcuts
love upright shortcuts but never fairly got the suspend of the present of Gmail's keyboard shortcuts? With Custom Keyboard Shortcuts enabled, you can adapt any of Gmail's default shortcuts to your fondness. Handy!

Forgetting Attachment Detector
Save manually the embarrassment of the next whoops-I-forgot! Message with the Forgotten Attachment Detector. It scans your contact to uncover about whether you had meant to confer a summary and alerts you if an attachment is absent.

Pictures in Chat
The Pictures in Chat aspect does right what it sounds like: adds addict icons to your Gmail Chat screen. This one won't boost your productivity all that much, but it's a nice little pinch.

240 gig hard drive for video iPods, the first two generations

2009-02-06T00:28:00.000+05:30

Admittedly, the price is still a little high, but if you have a large digital music collection at home and like all (or at least much of it) on a single iPod wants to be sure of with this service the company Rapid Repair have big ears.Against about 300 dollars (so much cheaper than SSDs of about this size) can be from March its video iPod in the first or second generation ...

... With a 240 gigabyte hard drive can equip. The first should be rich I think. The new Dual-Platter Mini Hard Drive (1.8 inch, 4200 rpm) from Toshiba is not only its predecessors in the number of revolutions (previously had 1.8 inch Dual-Platter HDDs from Toshiba 3600 rpm) but also in energy efficiency superior: The MK2431GAH HDD saves over the previous dual-Platter HDDs from Toshiba a full third of the energy.

Unfortunately, these small disks not involved in any other device installed, they work at the moment only in the first two video iPods. But on the other hand, who really need 240

Privacy protection on facebook

2009-02-06T00:16:00.001+05:30

i have come across people facing lot of problems related to their privacy on facebook.Here are top 5 solutions according to me

1. Use your friend lists

I can not tell you how many people are not aware of their friend lists.

For those who do not know what friend lists, Facebook describes it as

a function that "private groups of friends on the basis

on your personal preferences. For example, you can create a Friend List

for your friends to the weekly book club meetings. You can Friend lists for all your organizational needs, so you fast friends of the type and send messages to your lists. "

There are a few very important things to remember about the friend-lists:

You can enter any friend on more than one friend group

Friend groups are used as "tags", as elsewhere in the

Web

Friend lists, specific privacy provisions in it

I will comment briefly on each of the above things in detail later. A

typical setting for groups would be "Friends", "Family," and

"Professional". These three groups can then be used to different

from the party at night, but you do not want your family or

professional contacts, to see the photos.

With friend lists is also very useful for organizing your friends If you have a lot of them. For example, I have about 20 lists, and friend I categorize people by the city (New York, San Francisco, DC, Tel Aviv, etc.), where I met them (conferences, co-workers through this Blog), and my relationship to them (work, family, social, etc).

You can use your friend lists, by entering the area of your friends

Facebook.

2. Remove from Facebook search results

My mother is a teacher and one of the first things they asked me if they Facebook has joined, how they make sure that their students could not see that they are on the website. Understandably, my mother does not want their middle Pupils know what they are up to in their private lives. There are

many reasons that people do not want their information to show up in the search results on Facebook, and it is easy to turn the public visibility.

How to remove yourself from Facebook search results Now that you've decided that you want to remove themselves from Facebook's search results,

Visit Your Search privacy settings page

Under "Search Visibility" select "Only Friends" (Remember, it is From Facebook search results, make sure that you want to be completely removed. Otherwise, you can select another group, such as "My Networks and Friends ", which I believe is the default setting.)

Click "Save Changes"

By default, Facebook makes your presence visible on the network you are

in. Often people are unaware of their view, this is a from the initial settings that the user wish to modify. By selecting "Customize" from the drop-down view allows you to search your

More granular settings.

3. Remove from Google

Facebook is a ton of traffic from the display of user profiles on the lookout Motors. Not everyone in your profile is displayed if. Currently the Information displayed on the search is limited to: Your Profile Picture, a list of your friends a link to you as a friend, a link send a message and a list of up to about 20 fan sites that you are a member.

For some people in the search engines is a good way to

People are in contact with you, especially if you do not have a

existing site. Facebook also rank high in the search

Results, if you like, is easily found by your search profile

can be a good idea. Many people do not want all their information to

public.

By visiting the same search privacy settings page in the previous You can step the visibility of your search list, which is for Google and other search engines. Can you use your Search list, just uncheck the box next to the sentence "Create a search list for me and submit it for search engine

Indexing ".

4. Avoid the infamous photo / video days Mistake

This is the classic problem Facebook. They can lose for a few hours Night (or day) and pictures (or video), the moment suddenly posted for all, not just your friends who shared the time with Them. The result can be devastating. Some were fired from work incriminating photos / videos have been for the boss to see. For others, randomly tagged pictures / videos terminated relationships.

At least one tagged photo / video can lead to personal embarrassment.

How do you prevent the infamous tagged photos or videos are not displayed,

in all your friends news feeds? It's pretty simple. Your First Visit

Privacy profile page and change the setting next to photos of Tagged

You ". Select the option that says" Customize ... "and a field,

Select "Only me" and then "None of my network" if you to hold all the selected photos as private. If you wish, that we tagged Photos visible to specific users, you can select, insert it into the box

under the "Friends" option. In the field that after you Choose "Some friends" you can either single friends or acquaintances Lists.

5. Protect your albums

Just because you have uploaded photos, does not mean that you just tagged each photo correctly. This setting is more than a memory something else. Often people will be tagged by their photo

Visibility on certain lists friend nor their public photo albums the world. If you attempt to keep all your photos invisible, you must do on an album by album basis.

There is a special photo privacy page that you manually Configure the visibility of each album . This is a Configuration option very useful and I recommend that you

Use it. In this way, your photos for an indefinite period Facebook still ensure that only people who can share your photos the ones that you really want to see them.

i will soon be posting top 5 solutions to privacy control on facebook part 2 soon

till then blog and connect safe

Fast hard drives with memory chips

2009-02-05T20:21:00.000+05:30

Fast hard drives with memory chips instead of conventional mechanics keep feeding more and more often in modern computers. The memory manufacturer Transcend with Hauptsitzt in Taipei (Taiwan) now offers an external, very compact 1.8 inch hard disk SSD18M to go to, which consist of NAND flash memory is manufactured. Since the solid-state disk does not Platter, read / write heads, motors and so on, is very resistant to shocks, vibrations and shocks. Similarly, these hard drives consume less power than their predecessors.

The drive reached a very high literacy levels. If the existing eSATA connector used are 90MB / s reading and 50MB / s when writing possible. If no times available eSATA port, USB 2.0 provides high compatibility of connections to other computers or notebooks. The very durable disk is hidden in a plain, glossy casing with a diamond pattern. This is just 80 x 50 x 12.5 mm big and weighs 50g with HDD breathtaking. Thus, the hard disk for each armed and mobile use, only very rarely in the way. Available are 3 different capacities. As the smallest edition is a 32 GB SSD installed, the next largest has 64 GB capacity. The top model has 128 gigabytes of storage.

Street prices are not yet known, the price of Transcend referred recommendations amounted to 99.40 € (32 GB), 170 € (64 GB) and 312 € for the largest external with 128GB SSD.

Source: Transcend

Secret technology for the home theater

2009-02-05T16:37:00.000+05:30

More and more people now wear small cameras with him - whether in mobile phones or other mobile digital devices. The quality of the pictures that these cameras provide, however, is still relatively poor, how on platforms such as YouTube can see every day: football jerky, poorly lighted steps, or a baby verpixelte party cutouts are the rule rather than the exception. MotionDSP , a company from the San Mateo, California, wants this spring is a PC software available for download by some of the worst problems of digital moving pictures to be solved - from camera shake up to the bad lighting. The product named "vReveal" will cost $ 40 and is aimed at the average amateur filmmakers, which is a bit better holiday pictures want to make as little as possible but wants to spend money.

According MotionDSP CEO Sean Varah, the image enhancement algorithms originally developed for the U.S. secret service CIA developed abroad. The now standing before the publication of retail version includes an easy to use editing tool with which to cut and clip together can. It runs under Windows XP and Vista.

The idea of movies with the help of video optimization techniques to improve is by no means new. For years, software vendors, inter alia, on so-called "super-resolution algorithms, the scenes appear to be less blurry. It will provide information about the color and position of the pixels initially for a handful of frames collected and then to extrapolate additional image information. This will sharpen edges and jerky movements, supported by a trembling camera work is partially resolved. Salient Stills, an MIT spinoff, which was founded in 2000, used such super-resolution algorithms and other techniques to videos for law enforcement agencies to improve . More recently, Intel has also the potential of the image optimization in the context of new applications for multi-core processors are examined.

Apple's iMovie software to the most popular amateur programs include cut, announced at the Macworld trade show in January a new version, an automatic image stabilization is included. Also, Sony and Adobe video editors also to the corresponding optimization features for under $ 100 offer.

Varah still sees advantages in his home-made technology. vReveal was specifically designed for home users have been developed. "Sony and Adobe have, however, with high-end programs started. Denen were gradually deprived of functions to make them cheap enough to make it to ordinary consumers to be able to sell." Varah also stresses the MotionDSP algorithms due to their use in the CIA would have higher requirements must meet. Moreover, on several special patents, which researchers at the University of Santa Cruz have developed as technology MotionDSP chief Nikola Bozinovic says.

The algorithms of the company investigate movements across multiple frames to determine which parts of it due to abrupt camera emerged. These movements will then be deducted and the final result is calculated accordingly.

In order to increase the brightness without compromising the image quality can suffer too, continues to vReveal another trick: "Any software can do, this is simply the pixel intensity by a factor of two hochskaliert." The problem with this, so Bozinovic: This would include the noise in the signal increases, leading to a granular representation leads. MotionDSP Eliminate the noise, therefore, by a number of frames having an average will be taken.

Another function of vReal increases the effective number of individual images in a video. Many phones are only 15 frames per second, which means that movements of the human eye choppy effect. Around a video effect only from 30 individual frames per second. By analyzing the movements of individual objects within multiple frames vReveal therefore synthesized Between shots.

Laura Teodosio, co-founder of Salient Stills, says that the set of MotionDSP super-resolution technology is not exactly groundbreaking, was: "In these algorithms and techniques has improved in recent years only little changed."

Interestingly, however, attempt this approach is specific in the retail market to fetch. "The challenges in this sector are always two things: First, a product simple enough so that it remains operable, and secondly, the image enhancement clearly enough so that the user is applied again and again."

Should vReveal successful, could MotionDSP algorithms make their way into other software products. Middle of next year, the company wants a part of their source code to other developers is available. Companies such as Internet telephony provider Skype, they could be, for example, for its online services in order to improve the image quality without having to use more bandwidth. Moreover, Internet video providers like YouTube from technology to benefit the Samaritans to improve image quality.

Robots for battlefield medics

2009-02-05T16:17:00.000+05:30

The first 30 minutes after an injury in combat is critical then decides whether a soldier survives or dies. For a wounded care, however, must be first discovered and then often under heavy bombardment to be evacuated. That can cost minutes of the paramedics and even to make targets.

Researchers at Carnegie Mellon University (CMU) are developing a technology so that military doctors a helping hand - and in the truest sense of the word. Howie Choset, a lecturer in robotics at CMU, has a snake-like robot developed the various sensors includes the health of a soldier can monitor. The system can be wirelessly via joystick control, so a doctor in a distant hospital every point of the body, and may investigate to injuries during the evacuation to investigate. The flexibility of the arm allows that he is also moving in tight spaces, making even an initial medical review directly on the battlefield is possible.

Choset and his colleagues already are building for more than ten years of such "Snakebots, improve their movement potential and flexibility. Also it is a prototype for several miniaturization noted. In the past, the group has already robots for search and rescue missions and helped to create the Ford, a snake robot for precise auto painting to develop. The team also recently founded a start-up, one of the latest technologies from the laboratory Chosets commercialize be: A robot, which potentially serve as a heart surgeon could.

Currently, the CMU team with the Center for Telemedicine and new technology (TATRC) of the U.S. Army to make the robot arm in the high-tech grave of the Force to integrate. This so-called "Life Support for Trauma and Transport System (LSTAT) is a kind of portable intensive care unit with an integrated defibrillator, ventilator and a variety of physiological monitoring devices. The LSTAT is already used in several combat zones in Iraq and Afghanistan - medics can make a few patients with the built-up and technique to use his pension.

"There are all these sensors on board, with which we have preliminary diagnostic testing. It also helps us, the system first measures in order to save the patient," Choset said. The only problem was that the sensors on LSTAT appropriate and that they must move by hand. "If someone has been taken and we will help him become a target itself becomes light. That's why we wanted to automate the entire system and the sensors with the help of robotic technology to the patient to move while he was out of the battle area is taken."

Choset and his students have a very jointed arm created from multiple joints is driven, which gives a snake-like flexibility. Each joint has two of freedom, which, taken together, bending, pulling and turning movements in various configurations allow how she knows of reptiles.

Because it is impossible for a person, all of these joints by hand to steer, the team developed a software to precisely control the robot by joystick movements possible. In laboratory tests, the researchers were able to successfully arm the body during a skeleton entlangführen. An attached camera allowed the prosecution in the distance.

Choset has various physiological sensors attached to the robotic arm, including a CO2 and oxygen detector that can determine whether breathing is present. Also the robot could be an oxygen mask put on by him or a connection to the ventilation device, without the paramedics would have to help.

In future, even Choset ultrasonic components are integrated so that a patient quickly to internal bleeding can be checked. His team is collaborating with researchers at Georgetown University in a relevant essay. This is the useful, the robot needs a certain strength Sensibilitiäts ratio, to determine what force Aufdrücken when the probe on the body must be used, in order to get good pictures. This will Choset, along with other questions will soon investigate.

Sylvain Cardin, a senior researcher at the Medical Robotics TATRC, provides yet another military applications for the robot arm. "He could be sitting in a small vehicle that you send into battle area, and one medic, one might take the injured from the same remote support." Since then it does not matter whether the person still located under attack: "You can save people without having to sacrifice themselves to become.

Soon iphone will have multitasking feature

2009-02-05T16:08:00.000+05:30

I have read Mac Rumors that the team of Steve Jobs apparently serious about it, and soon to other providers of iPhone software (also applies to the iPod touch) in the App Store will allow their programs to run in the background . Currently, only a few applications (all from Apple), such as the mail program or music player.

This would allow it finally possible to use the Safari browser to surf the Internet and at the same time a messenger program such as ICQ and Twitterto have opened. According to Mac Rumors could be the "background feature with a firmware update soon on our current iPhones get indentation. However, with a limit of the background processes to a maximum of two applications.

The problem with the whole story is the little heady battery performance at both the iPhone 2G and the 3G iPhone - especially when one route is via UMTS. Probably, I could not so quickly see how the charge of my gen iPhones by 100 would be zero percent. From a possible loss of speed I will not talk. Nevertheless, I see the way in this case Apple's extremely positive. Perhaps there is soon a new iPhone - with a significant powerful, replaceable battery and a few nice new features more.

Riti, the printer of coffee used, the height of recycling

2009-02-05T00:25:00.000+05:30

I'm from the old-fashioned, old mill, a kilo bag of Colombian coffee beans (in fact Zamora) morning ritual and repeated several times throughout the day. Perhaps that is why I love this printer coffee, unfortunately only a concept so far. Therefore and because the ink cartridges will cost more than a toothache. The idea is simple: pick up your used coffee beans and get in a cartuchito that will serve as ink. The downside is that you must move the cartridge by hand from side to side, so you get a mace if you print novel. You can even make use other green herbs, but it would be too expensive and too risky. Anyway, I do not know if the idea is good, but very curious

IBM Sequoia

2009-02-05T00:17:00.000+05:30

20 petaflops. Is the processing speed of Sequoia, the next IBM supercomputer. Let me write it again: 20 petaflops, as you read. Not only is the world's fastest processor, but more than a list of the top 500 ... combined. 20,000 trillion operations per second. If the figure does not sound enough for you, IBM has provided some tangible ways to understand the future ability of its Sequoia:

If each of the 6700 million people use a calculator on the planet simultaneously 24 hours a day and 365 days a year (without going to the bathroom), take 320 years to do what they do in an hour Sequoia.

-20 Petaflops improve 50 times the ability to predict earthquakes, their effects can calculate building to building.

-20 Petaflops improve 40 times the capacity to monitor and predict the weather. Weather events could be calculated in an area of between 100 meters and 1 kilometer, instead of the estimated 10 kilometers available.

Sequoia will have 1.6 million cores with specific 45-nanometer chips still developing, and 1.6 petabytes of memory. You need 96 refrigerators and 280 square feet of space. The supercomputer will be impressive in the hands of the government of USA and I prefer not to think about what kind of real education is to be used

Rubiks Cube Magic'09: Round and for fun

2009-02-05T00:10:00.000+05:30

Once we have witnessed in recent times with all kinds are more likely plagirist attempts had to do, the legendary magic cube into the new century and millennium, to hoist, announces that Professor Rubik himself back.

His official position for a new trial is called Rubik 360 and it seems rather to what training the fine as the logic to be.

What is at issue, namely, at least, sounds relatively simple: It is a matter of colored balls from an inner ball into the corresponding openings of an outer ball control, taking them through openings in the middle of a ball must infiltrate, of which there are only two pieces.

Sounds somehow intellectually not so terribly exciting, but perhaps it goes even to the emancipation of those people who are always at fairs with sleepwalking certainty, exclude such gaming ..

OLED screen to measure

2009-02-05T00:03:00.000+05:30

OLED screen to measure

What could not do everything with flexible OLED displays employ?

For example, one could produce a display of the current visual needs of its user s adapts, such as that the draft was named Horizon supremacy.

depending on what you're watching will pull the screen just a little further on, on the other hand, one is forced, in a small space to work (such as Bobbele in the broom cupboard), push the screen together again.

Clever additional element: An integrated mini-projector, the important notices (such as that there is new mail) between the keyboard and display on the desk surface throws.

ZUNE PHONE

2009-02-05T00:01:00.000+05:30

Zune Phone: It would be

In Europe, the Zune player from Microsoft so just passed and if the rumors true that in the context of austerity measures in the world's largest software company, at least the zune's hardware section will kill, we will probably never more get to see.

Also, we will save the discussion whether a zune phone would be great now or not, even now - practically just before closing doors - a device still appears to be such a thing could / would be.

Toshiba - manufacturer of this phone called TG01 - namely bolted together and the Zune, and Windows Mobile 6 running mobile also has a certain similarity with the PMP.

Even at the operating system for the 9.9 mm thick smartphone with 4.1-inch display was herumgeschraubt, and supposedly makes it even then garnicht times sooo bad besides the iPhone and BlackBerry Bold.

The TG01 has GPS, HSDPA and HSUPA, and DivX support, and is connected to the Internet Explorer Mobile 6 with full Flash compatibility equipped - all in all sounds quite neat.

Custom dunny toy

2009-02-04T14:56:00.000+05:30

Artist Dustin Cantrell and Kidrobot Dunny classic toys ha come up with a new favorite: the Tesla-inspired Plasma Globe. But even crazier, he's ToyCyte letting one of these amazing creations away for free.

In a post on ToyCyte, Cantrell said he to the plasma Dunny was always a little sad to see Tesla's legacy to the schlocky products in places like Spencer's gifts, and wanted something cool with the plasma globe.

Plasma Globe was originally created by Nikola Tesla in 1894 and worked with a Tesla coil to excite the element in a hot lap. Then in the 1970s, MIT researcher Bill Parker met with the currently used modern design, with a glass dome with inert gases, and high-frequency current through the dome, the visual effects.

Information on competition in the plasma GiveAway Dunny can be found here, and if you do not happen to win-Don't-worry, there are three more for sale in the future (price unknown). [ToyCyte]

Google lattitude

2009-02-04T14:47:00.000+05:30

Google's released Latitude, a Maps tool that allows for automatic tracking of friends in real time, using a laptop, Symbian 60, Blackberry, WinMo and soon, iPhone or Android.

Laptops and cell phones (if they are not equipped with GPS) to find a fair level of accuracy with geotagged Wi-Fi and cell phone tower in a database that Google, on their own, perhaps with Streetview photography. Or you can set your location manually. Google said that there is no fixed standard, how often the map updates your location. Rather, they have an algorithm that depends on how often the device is moving, historically, and how much battery your device has left. You can also leave the service completely, and per-user settings, whether certain friends can your location to all, or if only at the city level for accuracy. Google says it may consider useful for family members to find out whether they are in a traffic jam or on the way home.

Most phones will be able to keep the map location updated in the background. Except the iPhone. What the iPhone users can do, as a work around, is to lock the phone with the Google app running. That'll keep the phone updating until batteries die.

The Blackberry, WinMo and Symbian phones and laptops/Desktops can use Latitude now by downloading the most recent version of Google Maps or hitting Http://google.com/latitude. The iPhone gets it with an updated version of the increasingly powerful Google app, soon, as does the Android powered G1.

250GB storage

2009-02-04T13:09:00.000+05:30

File Dropper and SmashingApps partnership to the green earth, with the hosting files, 250 GB, which will focus on the Green. Their reason is, with the free hosting files, you can find the documents electronically and do not waste paper by the pressure of all time.

Even though I am not sure whether the documents or the servers that do more harm to the environment, I believe, is a good business, because there is nothing to lose.

To be honest, you can actually skip right to Step 3 and create your account right way without pledging. In fact, I created my free account first before pledging. But it’s always good to play nice when someone is giving something for free, and for good deed.

Long story short, here’s how to claim your free 250GB free file hosting account:

Pledge about going green & link to SmashingApps (via Twitter, blog, YouTube or Flickr).
Post a comment on the SmashingApps blog post linking to the medium you’ve used to pledge.
Go to the File Dropper promotional page.
Create an account using the promotion code “smashingapps“.

Download just what u need from a zip or rar

2009-02-04T12:57:00.000+05:30

How many times have you not downloaded great. Zip or. Rar archives, because u only need one of the dozens of others in it? It happens quite often with me.

For example, I would normally hunt Designer icon to Twitter agencies. Most of these symbols of different sizes, colors and sizes, and are compressed into a file. Zip or. Rar file to download. But all I need is just a symbol of my blog, why should I all other unnecessary symbols?

Now problem is solved load scout .

And it works:
1. Copy and paste the URL (http or ftp) the. Zip or. Rar file you want, then click "OK."

2. All files in the file. Zip or. Few are listed and you can search and download the file.

3. Double-click each file you want to download, then select the exit path.

LoadScout could do more according to its website. It can show information of an .mp3 or .avi file without you downloading beforehand. You can also play part of a .mp3 or .avi file before downloading. This way you can identify the media file first before downloading, in case you’re downloading the wrong one. Too bad I am unsure how to get any of these features working.

[Download LoadScout] - Windows 95/98/Me or Windows NT 4.0/2000/XP (Vista).

Firefox-GET best out of it

2009-02-04T12:44:00.000+05:30

By default, Firefox is already very powerful internet browser, but you will probably not be optimally used. Most of Firefox is more than Firefox with less time. This will undoubtedly increase your productivity.

Firefox speed up
Chances are you've already seen what was in fact the shift millions of times over the Internet. But in case that you always have the default settings of Firefox, these tips will help to speed up Firefox.

Enter "about: config" into the address bar and press Enter.

In the filter, type “network.http”.

Set network.http.proxy.pipelining to ‘true’
Set network.http.pipelining to ‘true’
Set network.http.pipelining.maxrequests to ‘25′
Set network.http.max-persistent-connections-per-server to ‘22′

Now right-click anywhere, select New → Integer. Name it nglayout.initialpaint.delayand set its value to ‘0′.

You see the difference in the load on the website of Firefox. There are still many improvements in this area, you can Google to find out more.

More Room, Less Junk
So, you have faster loading Firefox, but there is still time, a lot of scrolling. There are a lot of buttons and menus on Firefox, and more than likely would not have some of them since the installation of Firefox.

"read the tuitorial on life hacker-Follow this guide"

Handy Extensions
One of the reason why Firefox is so popular because it has a very extensive library of extensions. Firefox add-ons, your performance and increase productivity.

One of the most useful, I think the expansion will benefit everyone:

DownThemAll! - There is a download manager for Firefox, which you like to have. Why? Since you're happy, your download speed to be increased up to 400% faster download, and lots of pictures and files on a site in the clicks. It is logical that the download files faster speed you can gain more time.

Recommendations fast online has a great list of 50 extensions for Firefox to surf. Pick a few of them that you believe is in their hands, or you can also see the full extent of the library.

Hotkeys! Abbreviations! Everything you call ...
Trust me, to become accustomed to keyboard shortcuts can really create a lot of time and may lead to the results much faster. My shortcuts, which I often:

Ctrl + T - Open a new tab
Ctrl + Shift + T - Open last closed tab
Ctrl + N - New Window
Ctrl + W - Close Tab
Ctrl + + - the size of the police
Ctrl + - - Reduce the font size
Ctrl + Tab - Go to the tab (like the Windows Alt + Tab)
Ctrl + U - Open the source of the page
F5 - Reload
F11 - fullscreen

Medium-click on the link - Open a link in a new tab
Middle clicking on the tab "- Tab

For the complete list of keyboard and mouse

Do you have any further recommendations can make Firefox more useful? Let me know in a comment below.

Offline gmail

2009-02-04T12:40:00.000+05:30

Gmail is my main mail client for years for its simplicity, efficiency and speed. With the new Gmail Labs feature, namely offline Gmail, Google had successfully finished bother me, for all alternatives.

Gmail is offline Google Gears, which is about to download a local cache of your e-mail to retrieve and synchronize with the mail servers of Google, as you are online. If no connection is available, you can access the locally Gmail with your browser, not just what you can, if you're online (with the exception of Google Talk, of course).

If the connection is available again, what you did, just off-line must be synchronized with Gmail's servers again. Offline e-mails are sent, the stars and the labels are updated, etc.

Like other Google services, the new feature is slowly rolled. If you do not see your Gmail Labs, you must in a few days, unless you are not with Gmail English (U.S. & UK).

If you use Gmail offline Gmail Labs already, you can, and do it by clicking on the "Offline0.1", next on the upper right corner.

Following Flacky mode is interesting. It synchronizes your e-mails with the server in the background, but Gmail is still with the local cache.

Official Gmail Blog - New on Labs: Google Mail Offline

Updates:
Gmail is offline on my Gmail account after less than 24 hours after publication. Gmail downloaded a year for a total value of my Mail Archive, with its annexes.

Although I Flacky Connection mode can be used to speed things up, even though we are on a decent connection. But it appears that, in conjunction Flacky mode, images in emails are not displayed. If most of your emails on the basic text and images, Flacky result is useful to speed things up, otherwise, do not use if the Internet connection is slow or unstable.

THE TIP OF MY TONGUE

2009-02-04T12:34:00.000+05:30

I am pretty sure that you are on a situation in which, You know a word, but could not remember this
long time. You know how short tones, a little idea of as if by magic, and that the meaning of the word. As
annoying is that?

With the Tip of My Tongue, it will be much easier to obtain Word at the top again. Simply enter all know Using the word in the filters on the left side, and
Start your search and display the results right
Real time.

The four filters are partial word (it starts with,
contains, ends with), letters (decryption, this should
can not be), a word which means (1, 2, 3) and Refine your search
(min. max. length, sounds like).

To say I have a word for portable computers, I
you can use the word "portable" and "computer" in the third
Filter, and voila, the results appear almost
immediately, with "laptop" is the first result.

The tool is not perfect, and sometimes can not work if
nothing to do with the information that you
Filter. But it's worth it the next time that "what
Word that was new? "The situation strikes, but as
banging his head against the wall.

rapidshare premium link generator

2009-02-04T12:18:00.000+05:30

Link Generator

Www.Proxiez.Net
Max No of links you can generate daily: 5

Www.Rapidhack.Net
Max No of links you can generate daily: Unlimited

Www.Fedho.Com
Max No of links you can generate daily: Unknown

Www.Fastaccess.Ws
Max No of links you can generate daily: Unknown
You must register before you can generate WID
Links

Www.RapidsharePremiumLinkGenerator.Com
Max No of links you can generate daily: Unknown

. com Link Generators

Www.RapidDownloader.Info
Max No of links you can generate daily: Unknown

Www.Khongbiet.Com
Max No of links you can generate daily: Unknown

Www.Proxiez.Net
Max No of links you can generate daily: Unknown
Generator continues to test

Www.RapidSteal.Info
Max No of links you can generate daily: 6

Www.rap-Hook.Com
Max No of links you can generate daily: 4

Www.FreeRsLinks.Com
Max No of links you can generate daily: 100

Www.Rapidl.Com
Max No of links you can generate daily: 3

Www.RapidPremium.Info
Max No of links you can generate daily: Unknown

Www.DownloadMyUpload.Com
Max No of links you can generate daily: 7

Www.RapidFile.Us
Max No of links you can generate daily: 2

Www.RapidRapid.Info
Max No of links you can generate daily: Unknown

Www.Rapidshare.Co.In
Max No of links you can generate daily: 5

Www.Rapidshack.Us
Max No of links you can generate daily: Unknown

Www.Megaez.Com
Max No of links you can generate daily: Unknown

Www.RapidsharePremiumLinkGenerator.Com
Max No of links you can generate daily: Unknown

Www.RapidKing.Info
Max No of links you can generate daily: 3

Www.RapidLoader.Info
Max No of links you can generate daily: 15

Www.Premium4Me.Com
Max No of links you can generate daily: Unknown

Www.RapitShare.Info
Max No of links you can generate daily: 5

Www.RsLeech.Info
Max No of links you can generate daily: 8

Www.RapidLeech.com
Max No of links you can generate daily: Unknown

Www.Rapidx.Info
Max No of links you can generate daily: 3

Www.RapidMate.Info
Max No of links you can generate daily: 5

Www.RapidSet.Info
Max No of links you can generate daily: 3

Www.RapidR.Info
Max No of links you can generate daily: Unknown

Www.RsProxy.Info
Max No of links you can generate daily: 5

Www.RsFox.Com
Max No of links you can generate daily: 5

Www.PremiumLinkz.Info
Max No of links you can generate daily: 5

Www.Rs43.Com
Max No of links you can generate daily: Unknown

Www.RsAlmighty.Com
Max No of links you can generate daily: Unknown

Www.Dioscurionline.Net
Max No of links you can generate daily: 2

Www.FreeRapid.Org
Max No of links you can generate daily: Unknown

Www.Rapid4All.Com
Max No of links you can generate daily: 5

Www.RsDln.Com
Max No of links you can generate daily: Unknown

Www.Warez-Premium.Org
Max No of links you can generate daily: 5

Www.Rapidshare2Hell.Co.Nr
Max No of links you can generate daily: Unknown

Www.RapidCheat.Com
Max No of links you can generate daily: 5

Www.NobakWaas.Com
Max No of links you can generate daily: Unknown

Www.Adomreg.Com
Max No of links you can generate daily: Unknown

Www.DontFilter.Info
Max No of links you can generate daily: Unknown

Www.Premiumakers.Com
Max No of links you can generate daily: Unknown

Www.FirePremiums.Com
Max No of links you can generate daily: Unknown

Run batteries

2009-02-04T12:10:00.002+05:30

Run batteries

When running generate electricity

For many runners is an MP3 player now for the same equipment as the trainers. only that long distances often the batteries are left behind. So now inventors develop batteries that are running to recharge.

Joggers may soon be running their electrical charge.

. The supply of mobile phones, PDAs and MP3 players with energy is a huge problem. What use the many great features that allow manufacturers to equip their devices if they consume as much electricity, batteries that in a short time are empty and the actual function you can not use? Experts are confident that the inventor of the power supply on a viable solution, will earn a gold nose.

"These technologies have great market potential," is Hinte Ralph Mann, an expert on IT and innovation markets in the industry association Bitkom, convinced. First promising solutions already exist - even if not all technical problems for daily use are resolved, "said Hintermann.

There are idiosyncratic innovations, but only for truly mobile people are capable of - for less sedentary. The U.S. startup M2E Power, for example, wants a battery on the market, exacerbated by moving charges. "Who him for six hours in your pocket or backpack around with them, is enough energy for one hour to produce mobile phone", the developers promise. However, the first solution in the form of a charger with extra battery on the market - until a year later to follow self-rechargeable batteries in the mobile phone to stay.

The operating principle is simple: It is based on electromagnetic induction, in the smallest movements of a load between the magnet and coil produce. According to M2E Power CEO David Rowe cellphone manufacturers show great interest in the technology.

One promising way to more powerful battery is also the piezo technology.Researchers at Texas A & M University, with extremely thin lead zirconate titanate a piezo electric material, which precisely at a thickness of 21 nanometers, the energy yield doubled. This could be the battery life significantly improved.

And not only that: Again movement ensures that electricity is produced. The ultra-thin material itself by changing the pressure and sound waves resulting kinetic energy into electricity in order. According to Tahir Cagin developer of the Texas A & M University could, therefore, even a call for new electricity. When the idea to the market could, however, he still can not say.

Even the heat from heated silicon nanowires could lead to the generation of mobile devices are used. Was already sufficient for the body heat or waste heat from processors, researchers from Lawrence Berkeley Laboratory and the University of California at Berkeley. The trick is in the physical principle of thermo electricity: When a thermoplastic material with electrical properties on the one side is heated, it begins in the electrons from the hot to cold side to walk - and it is flowing electricity.

This effect can also be the smallest area with a fine mesh of silicon wires reach.Surprising thing is that he, even without a metal can be achieved. In this constellation is similar to the silicon powerful as the best existing thermoelectric material, "says the head of the research teams, Peidong Yang. The development is, however, also at a very early stage.

Considerably more - but also bizarre - is the solution of the Japanese operator NTT Docomo, which has developed a shoe, which is also kinetic energy converts into electricity. The Techno slippers with its wires and boards still looks like fresh from the lab arisen. Its sole is filled with water, which at every step by a small turbine is pressed, which drives a generator.

This small stream provides much power 1.2 watts, allowing for comfortable walking and an MP3 player with power could be. Currently, the developer of NTT busy, the power flow from foot to head as far as possible to accomplish without cable and the power to three watts to increase, which for the mobile operation would suffice. Moreover, the shoe, as he planned in 2010 on the market, are still chic. A Manolo it is never can be, but after a handicraft work of physics students, it may not even look.

Glimpse into the molecular world

2009-02-04T12:05:00.002+05:30

Glimpse into the molecular world

Researchers develop new super microscope

Researchers from IBM and Stanford University have created a new super-microscope, which in unprecedented structures may be: The device is still structures of 4 nanometers size three-dimensional dar.

The new technology promises unusual insights into the world of smaller and smaller.

. The development of scientists based on the magnetic atomic force microscopy (Magnetic Resonance Force Microscopy, MRFM). Here, the magnetic field of a surface with the help of so-called Superconducting Quantum Interference units scanned. The procedure is similar to the well-known from the medical magnetic resonance imaging (MRI), however, is the resolution, according to the developer 100 million times higher.

IBM researchers have been working since the 90s at the MRFM. They succeeded, the sensitivity of the method once again to increase, so that it is extremely weak magnetic forces can be measured. Moreover, they have the procedure with a 3D image reconstruction methods.

First, they have used technology on a tobacco mosaic virus. It was a 3D view of the virus with a resolution of 4 nanometers create. That is 4 millionth of a millimeter. The virus attaches itself 18 nanometers in diameter. It was the first time that MRI for the observation of biological objects in the nanometer range has been used, so IBM.

MRI is an important tool in medicine, but for microscopy it is only suitable, said Dan Rugar, manager for Nanobereichstudien at IBM Research. Using the new technique will enable the internal structure of individual protein molecules and molecular complexes, something very important for understanding biological functions is. "This technology is the way we like viruses, bacteria, proteins and other biological elements, modify," says Mark Dean, a senior employee at IBM Research.

3D Comes at home

2009-02-04T12:01:00.000+05:30

Industry estimates in U.S. households is now around two million television sets, with a corresponding additional equipment basically 3D capable. The problem is: There are still too few 3D content. At the CES consumer electronics show in Las Vegas showed manufacturers and 3D production companies recently the potential that the plastic images even in the living room could have. They hope that the technology in a few years in the mainstream will take place.

In recent decades, the 3D technology developed strongly. The famous red and green glasses glued to ensure that two different images merge with each other spatially, but also distort the color is snow from yesterday. Directors and cameramen have also stopped on typical 3D gimmicks to bring the front of the nose of the spectators appear. Instead, they use the third dimension in order to better their stories to tell.

The current state of technology could be admired at the CES: Mitsubishi, Samsung, Panasonic, Sony and JVC showed all 3D products. Companies like RealD and Dolby have developed systems to correct the image information for the left and right eye with special lenses which are polarized two different versions of video images for each eye to filter out. Mitsubishi and Samsung TV show, which is another 3D Brillenart can use: This technique relies on the timing of the frames and an infrared signal that they are synchronized.To make this work, the TV with at least 120 hertz run to make the information for the left and the right eye with 60 Hertz arrive. Philips also offers a display, all without glasses anymore: The 3D TV special of the group plays videos from the two frames for each scene included - the one with the color and the other with the depth information in grayscale. Lenses on the screen even slightly projecting these images then shifted to the left and right eye - the illusion of spatial depth created.

"3D is primarily due to the increasing amount of film material to ride on," says Mark Hartney, executive director of the consortium 3d@home an organization created in 2008 was to adopt the technology faster. "Hannah Montana" and "Journey to the Center of the Earth" were both published 2008 in 3D.Hollywood responds with more Replenishment: 2009 are three times as many 3D movies scheduled as yet in the previous year. The film industry already has some of the biggest production and postproduction problems. Thus, highly efficient 3D cameras, which together with a matching software to ensure that it can hardly be artifacts during playback comes. This improves the picture significantly. "People have become more accustomed to 3-D productions for the cinema to see." The big question now is, says Hartney, as the trend also can get into your living room.

One method is to broaden the supply of 3D material about the sport. At the CES show, Sony and the production company 3ality a three-dimensional version of the FedEx BCS Championship football game between the University of Florida and the University of Oklahoma in a movie theater in Las Vegas. The game was also broadcast live in 3D to more than 80 other houses across the country sent.

In the living room fighting technique especially now with a big challenge: The necessary bandwidth of the signal is increased, because now two images (for one eye of a) to be transported home. This requires the material before sending compressed. This makes the development of appropriate standards necessary to ensure that the viewing experience for different displays remains similar. "There are a handful of companies who currently works at compression formats, including Sensio and TDV" says Hartney. They seek to existing TV standards compliant, 2D to 3D in order to be able to migrate.

Chris Chinook, President of the display-technology-consulting firm Insight Media, predicts that 3D in the living room first budget in 2009 will conquer. The mainstream would be the plastic image but only in a few years: "Much still evolving and is only expected in the industry," he says. That the technology at the CES as wide could see, however, was an important step - even the support of prominent companies. "In 2009, the momentum continues to grow." With diverse products fully expects the market observers, however, until early 2010.

GOOGLE DIVES TO THE SEA

2009-02-04T11:56:00.001+05:30

With Google Earth to explore the ocean floor: Main function on Monday presented the new version of the program is a map of

the seabed and a lot of information about the ocean habitat. These include previously unreleased footage of the French marine explorer Jacque Cousteau. Who does not go under water, you can use with Google Earth 5.0 also visit Mars.

The new software allows virtual dive trips to the deepest places of the earth's surface.Photo: ap

About Google Earth see immediately why the earth, the blue planet is called: Good three-quarters of the earth's surface is covered with water. Previously offered only Google Earth maps of the country.The changes however with the new version 5.0 of the program, the Google CEO Eric Schmidt and former U.S. vice president and chief environmentalist Al Gore on Monday in San Francisco have presented.

The water surface is in the new version is transparent, so that the user already from space structures on the seabed can recognize.At the approach is no longer at the final surface, but the user can now move on to the bottom of the Atlantic penetrate, underwater mountains, or climb in the footsteps of Jacques Piccard to the lowest point of the earth's surface, the trench hinabtauchen Maria.

Besides the virtual dive trips, users may be 20 levels to oceanic themes display the partial partners have contributed. For example, the Cousteau Society, around 90 videos from the archives of the French marine explorer Jacques Cousteau helped. The videos, from the 60s and 70s, are part never been broadcast. In addition to the Cousteau Society also have the BBC and the U.S. National Geographic magazine articles, pictures and videos on marine topics are available, some of them also in German.

The goal of Google Ocean, says Stefan Keuchel explained, spokesman for Google Germany, on the importance of the sea habitat and its condition noted."In the debates on climate change, the world's oceans are often overlooked, although in this area play a crucial role. Approximately one third of the votes of people in the carbon dioxide reaches the oceans, "said Google CEO Schmidt.This caused extinction in the coming decades, "is roughly equivalent to the loss of the entire Amazon equal." A level shows information about over another, however, documented the experiment, important habitats such as the Great Barrier Reef of Australia through the establishment of protected areas to preserve.

In addition to educational content is also fun too: Several levels of water sports can be as divers, surfers or sailors, the best spots to view and of course information and even add images. For divers are also the locations of over 100 wrecks with pictures and videos documented.

Two years, according to Keuchel the development time, at various academic institutions such as the National Oceanic and Atmospheric Administration were involved. For the duration was the animation of the water surface, which the designers great difficulties. A year ago, so Keuchel, have not yet looked, that they may have been present.

If the sea is not geheuer, you can use with Google Earth 5.0 also a virtual exploration of Mars for yourself: With a click on the planet icon allows users to start our neighboring planets and 3D views, maps and pictures of various Mars missions View.

New are also the so-called virtual time travel, through the integration of old aerial and satellite imagery made possible. The earliest images date from the 40s and show aerial views of cities in the United States. In addition, Google has also integrated its satellite imagery older.

By clicking on the clock icon displays a timeline on which the user is older views of the current site can show. So he can about the construction of Berlin's main railway station, from 2000, follow. Other innovations are the opportunities, tours and a video recorded using a voice comment on which, as well as tours of GPS devices in the program to load. This was previously only available in the paid Pro version.

The software, according to Google since publication in 2005 over 400 million copies downloaded, is now available at earth.google.com for download. The version 5.0 is available in 40 languages, 14 more than its predecessor.

India plans 10-dollar laptop

2009-02-04T11:51:00.002+05:30

Computer for all

India plans 10-dollar laptop

The Indian government wants an ultra-cheap laptop on the market. The device, for just ten U.S. dollars is to help students from poorer regions of the country to recruit. When presenting the project in South India Tirupati, however, it was only once when announcements.

Nicholas Negroponte, founder of the OLPC initiative, before a picture of the 100-dollar laptops.India wants the price of a cheap computer with its own model offer.

. Actually he had on today's Tuesday of the public to be presented. But the 10-dollar laptop, with the Indian Ministry of Education, the educational opportunities of children from poorer regions to improve, remains a phantom. During the presentation Tirupati in southern India has been eagerly awaited prototype in any case not presented.

Instead, Education Minister repeated RP Agrawal only some technical details that are already in advance of the event had become known: Wi-Fi capable, and he should have two gigabytes of RAM available. That's it then, but also in technical information - information about how a laptop at such low prices can be established, were not made.

In six months, the "Phantom" available - 940 million U.S. dollars (around 740 million euros) wants the Indian government to allow the project cost. The laptop will mainly be used in those regions are used, where computer use because of poor power supply and lack of Internet connections has hardly possible.

The Education Ministry hopes that it, more children from poorer sections of the population for higher education to be able to recruit. In advance of the presentation was known that the Indian government with several publishing houses will cooperate to teaching materials in digital form to the computer can be loaded.

The Indian low-cost laptop would be a much cheaper alternative to the computers of the "One Laptop per Child" project (OLPC). The initiative, by Nicholas Negroponte, a professor at the elite U.S. university MIT, wants specifically for use in less developed regions built laptops for the price $ 100 on the market. The OLPC computers will include a hand crank for power generation equipment.

According to the newspaper "Times of India Government of India has recently against the purchase of OLPC computers pronounced. As a reason for this, among other hidden costs of the project, which the price of such laptops at $ 200 would drive.

Facebook for Executives

2009-02-04T11:43:00.000+05:30

Who has a problem, like seeking solace and advice from people who live in the same situation stuck. Perhaps that is the secret behind the success of the Internet platform "Meet the Boss" - a sort of "Facebook" for executives from the financial sector, during the financial crisis has grown rapidly.

LONDON. Unlike Facebook meettheboss.com are not swapped baby pictures, and flirted will not. In the video conferencing and forums, is solely and strictly to professional and, of course, plays the current financial crisis, a prominent role.

Access to the platform gets only the operators who as a manager of the financial sector classify, for journalists and those who use the site would like to promote their products or services to sell, it is against: "We must unfortunately remain outside." "We reject about two-thirds of all candidates, which are about 100 requests per day," says Spencer Green, Chairman of Meet the Boss.

Despite this rejection rate, the website since its launch last September attracted 30 000 members. This includes executives from Barclays, Goldman Sachs and Visa. Most of the members is currently the French bank BNP Paribas, followed by Deutsche Bank and the U.S. monetary house Citigroup. "With 50 000 members, we make conclusions," says Green. "We want to keep the club exclusive."

So far, the major financial crisis to the new forum used rather than harm. "Of course you do not know how the long-term consequences of the crisis for us to look, but when the U.S. investment bank Lehman Brothers collapsed, the traffic on our site by 60 percent," says Green.

About "Meet the Boss", the executives not only via the internet, email or SMS to communicate with each other. Regular members initiated and moderated discussion forums. For example, Gautam Bose from the U.S. bank Wachovia just completed a round-table discussion on the topic, "how will the current crisis in the management of customer impact? started.

Membership is free. Similarly, advertising is very sparse on the page. The project will be financed by British publishers and conference organizers GDS International, the project mainly the commitment to strengthen its customer wants. "Of course, we try to cover our costs, but at the moment is to make profits is not the most important thing for us," says Green.

Best Facebook Apps

2009-02-04T11:21:00.001+05:30

GET the best facebook apps
MyLists allows you to create simple lists and share them with others.

Zoho: You can add Zoho to your Facebook profile; this gives you the power to write all your office-ish documents.

Social bookmarking and networking

Update your Twitter status from Facebook with Twitter for Facebook.

Media

Create your own personal multimedia channel - podcasts, videos, documents, pretty much anything - with SplashCast for Facebook. For example, I was able to find the last 30 or so NPR programs and tweak them into one long-running show - you can also use this to create presentations from .ppt files on your machine and share them with others.

Editing

Edit photos from within Facebook with the Picnik application. You can edit photos from your own 'puter, the Web, Flickr, Picasa, etc.

Use Picasa within Facebook with the Picasa app; you can upload photos, resize them, share images, and more.

Some other interesting ones are

(fluff)Friends. This application lets you put a fuzzy pet on your profile that your friends can feed and pet. You need "munny" to buy food for your pet, and you earn it by petting your friends' pets. Horrible. But three people mentioned this application to me.

Scrabulous is Scrabble in Facebook. Scrabble is a great social game. Facebook is a great social directory. This is a great idea.

E-mail Me Instead, aka Xobni, is a little application for old folks like me who still like e-mail. It gives your profile visitors a quick way to drop you an e-mail, so you don't have to communicate through Facebook.

Appsaholic is a Facebook ranking service. No surprise that it was popular at the Facebook HQ. It shows which applications are getting traction, and displays nice charts and graphs of usage

Graffiti. If installed, this lets friends deface a small area of your profile page. Most people who mentioned this application didn't like using it, since they found it hard to create good-looking tags on other peoples' pages, but they kind of still liked it on their own pages.

Finally, Flixster is a group movie rating site. After you rate a bunch of movies, it tells you which of your friends you are most compatible with--at least as movie buddies.